The name covers two different molecules
"TB-500" is one of the few names in this category that does not reliably identify a single substance. Depending on the supplier, it is used for either of two related but distinct materials, and they differ in size by roughly a factor of five.
- Thymosin beta-4, usually written Tβ4: a 43-residue peptide with a mass near 4,960 g/mol.
- A short synthetic fragment of that sequence, built around the actin-binding motif LKKTETQ, with a mass in the region of 900 g/mol.
Both are sold under the same four characters. This is not a subtle labelling preference — a vial of one is not a substitute for a vial of the other, and no amount of reading the product name will tell you which is inside. The analytical report will.
How the report settles it
The mass on the identity line is the discriminator, and it is not a close call. A result near 4,960 g/mol describes the full 43-residue peptide. A result near 900 describes the fragment. There is no ambiguity between those two numbers, which makes this one of the clearest examples of why an identity result is worth more than a product title.
Where identity is reported by retention-time matching rather than by mass — stated as HPLC-RTM on a certificate — the same logic applies one step removed: the method's reference standard defines what the retention time is being matched against, so the report should name which material that standard was. If a report names neither a mass nor a reference material, it has not told you which molecule you have.
| If the report shows | The material is | Residue count |
|---|---|---|
| Mass near 4,960 g/mol | Thymosin beta-4, full sequence | 43 |
| Mass near 900 g/mol | Short actin-binding fragment | 7 or so, depending on construct |
| Neither stated | Undetermined — ask before relying on it | — |
The sequence, and why the fragment exists at all
The full 43-residue sequence of thymosin beta-4 is, in single-letter notation, SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES. Within it, the seven residues LKKTETQ form the region associated in the literature with actin binding, which is why a short construct centred on that motif is made and studied separately.
Two consequences follow for anyone reading a report:
- A 43-residue chain is hard to synthesise cleanly. Every coupling step is another opportunity for a deletion sequence, so a full-length product has more ways to accumulate closely related impurities than a short one. Purity figures should be read with that in mind, and the chromatogram matters more than the headline number.
- The sequence contains methionine. Methionine oxidises readily, and the oxidised species differs from the parent by 16 mass units — a difference a mass-based identity result can resolve directly. This is the opposite situation to BPC-157, whose sequence contains no methionine and no cysteine and is therefore not oxidation-driven.
Storage of the lyophilized solid
As a freeze-dried solid, stored cold and sealed, either material is comparatively stable. The considerations that matter are temperature, moisture, and — because of the methionine — exposure to air over time. A vial brought from cold storage into a warm room will condense atmospheric moisture if it is opened before it has equilibrated, and adsorbed water is what allows chemistry to proceed in what looks like a dry solid.
Stability is a documented property rather than an assumed one. Where a supplier states a retest date or a storage condition, the question worth asking is what data supports it. Storing lyophilized research materials covers the general case.
What the published literature covers
The research record is preclinical. Published work on thymosin beta-4 and on the short fragment is dominated by cell-culture systems and animal models, with reported areas of investigation including actin regulation, tissue-repair models, and cell-migration assays. A great deal of the literature describes the full 43-residue peptide rather than the fragment, which is a further reason the distinction above matters when reading a paper alongside a product.
As with every compound in this category: neither material has completed the regulatory process that would establish safety or efficacy for any medical indication, and findings in cell culture and animal models do not transfer automatically to other species. Arctic Lab Supply does not publish research conclusions, recommend applications, or provide guidance on experimental design.